SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9G5L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9G5L5
Domain Number 1 Region: 1142-1281,1342-1408
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.18e-36
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 2 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000902
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 67-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000248
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9G5L5
Sequence length 1410
Comment (tr|H9G5L5|H9G5L5_ANOCA) Proteoglycan 4 {ECO:0000313|Ensembl:ENSACAP00000001743} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=PRG4 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MAWNIYCTSLLFLTVFLAQQVSSQDVSSCEGRCGEGYNRQHGCQCDSNCLLYAECCPDYQ
TICVEDLSCKGRCTAHFVRGKPCDCDPDCNTFGKCCPDFEEACPPIVQIQNPSTTTTVLP
ISTTTKPPTTTPKIKSTTKRSPKLNSKPKPKPKPKPKPKPKPKPLKKKKKQKKSSMSSSS
SSKIRRTMASVTNTGDKPKKKNGKNARESKSKLKSSKSKAVKVISEEDGSGVENALTTAG
TTTSTARQSSTASTTRVPSTTTTTTEVPSTTTKTTTEVPSTTTTTTTKLPPTTTTTSITT
TTVKQPTTTMPTTQLTPTTTTTTNLPPTTLIYTKTPTPQTEKVTTSLRSATPKPLNLLSS
TASIINKQLTLSTVATIRANKDTDSAVQKTTISPAKDTMTISKRDTTTATSEAVEDINNA
NNQAVTTVGKSEATNERVTTTANKDYIATDIKERITNEDIYSTPATLFTNTPQTEEHRHT
TPQTDPNDTSPSTVYKSDQPEETTTITETTITQTDPNDTSPSTVDKSDQPEETTTITETT
ITQTDPNDTSPSTVDKSDQPEETTTITETTITQTDPNDTSPSTVDKSDQPEETTTVTETT
ITQTDPNDTSPSTVDKSDQPEETTTVTETTITQTDPNDTSPSTVDKSDQPEKTTTITETT
ITQTDPNDTSPSTVDKSDKPEGITTVTETTITQTDPNDTTTPSSVDKTDYPDKSVPVTII
TDSSSEPPTPLNDDKSITETSLAESTPSPASDDKNNTPEITTTVSKMIITEDPYPEVVTP
NPDAETTNDKPTPSLDDRNNNPEVTSTVTETIVTESDPLSPIGISENVPSTGKPELPEEI
TQTEPPNDEPNPNTDENGERPKDITKIIETTTITNSPQSTPNPGEQDNPTKVTETTTAIT
TESKPLSDSPNSDASDRPDSITTVTKTTTTTTTESSPSTDDSDKNDNPEVITKITRTVTT
ITTTTTTTTQSNTTEHPETITQNVTTNTKIDLVSDREPTKENPTTKNTDTTVKEETIISS
IISKPVNTPPFVEDQTTGQTSPSPTARIPTRRRQVTYYPNLNHTQHIASGDLRTKSSNQV
EGTRCIEEGGKDKDGGSWEGSLDHLGLNRHMLLKKALSDEVYFCKNDNMANYFAPDIPDE
MNLCNRKAADGIVPLRNGSLAVFRGHYYWLLNGTTPPTPSPRRITEVWGIPSPIDTVFSR
CNCDGKTFFFKDSQYWRFTNDVMDVGYPKLIIKGFGGLSGRITGALSVANHKNRPESVYF
FKKVNLGGNLQQYTYKQEGPKKCKKKIVSVKYPIYKPKPVIRRRRRFERAVRPHFIRSVR
VQHYPVVQINTQPTGILQPEVKVTTYWRGFPKEVNSVISIPNYQKPDGYDYYAFSKDQYY
SVDVGSRIARPVTLQTGQTVSNAWYKCPAE
Download sequence
Identical sequences H9G5L5
ENSACAP00000001743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]