SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9GAK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GAK2
Domain Number 1 Region: 680-826
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-39
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1008-1104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2e-28
Family Ras-binding domain, RBD 0.00099
Further Details:      
 
Domain Number 3 Region: 226-359
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-21
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 4 Region: 11-97
Classification Level Classification E-value
Superfamily PDZ domain-like 5.59e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 954-1022
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000568
Family Ubiquitin-related 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9GAK2
Sequence length 1401
Comment (tr|H9GAK2|H9GAK2_ANOCA) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSACAP00000005660} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=RGS12 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MQRPGEKVKCRMHMQGSSIRNVEVARGRAGYGFTISGQAPCILSCVLKGSPADFVGLKAG
DKILAINDINVKKASHEDVVKLIGKCSGVLHMVIAEGVGHMDFCSSDEEVELYDGKGLHK
PKLDSKGLGINRAEKVVEEMQSGGIFNMIFEKSNICADNLQTSIRKQIPVNEIAVDKLET
ESEHRINNLNYFYHEELPKALHNDSEFRNGLENQEYFGLDASILNVAMVVGYLGSIELPY
SSSNLEYDSLQAIRGCMRRLRAEQKIHLLVVMKIMHDCIQLCNNKSSVIAEYPAEKLAFS
ATCPDDRRFFGLVTMQTIDDASLAQEEETVLRTSCHVFMVDPELFQHKIHQGIAQRFRLE
CTADPDTNGCLEFPMSSLPVLQFISVLYRDMGEFIEGVRARAFLDGDGDVHQNNSMSSNS
DSGIGNFNQEEKSNRVLVVDLGANSSKYVPSSLQDNPVDRGQAVLSWNVDHEQEGNSAFE
AMLQNDKSQHLSKFLASSAHIEVPLISPKSSVTPCKKNSVDISTQRYLPVHVLKDWQHGC
VSDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVNGGFGQPHLISQKNKFSKKEFHMQ
NMFESHSGSKKTREDKKWMKFGAASGLVQFTQRSTRRSFGRQKRFSITRSLDNLESAAVS
DGELNTTDLKDCVSDNSLSSNASLPSVQSCRRHRERRVASWAVSFERLLQDPVGVRYFSE
FLRKEFSEENILFWQACEYFHHISAHDKKELSFRAREIFNKFLCSKATTPVNIDSQAQLA
DDVLNAPHPDMFKDQQLQIFNLMKFDSYTRFLKSPVYQECILAEVEGRPVPDPQFVSSSP
TSKHSLGSEWSTASTPKKLGGKSKSGRSLNEESGEEDSERKKRGAFFSWSRSKSLGRSQK
KKENGGCSTDSTQPNGLSYRHESQDSLSSAASLEMIDSFRAPGSATGKGKSSKCCNINLP
DGSSYTMTLKAGVSIKEMLSGFCEKQGINIAAVDLFLVGGDKPLVLHQDSSILESRALRL
EKRTLFRLDLIPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNNLVARLNGEQEPLDLGV
PISNLDGQRVILDERLPKKGKDQGKGTSLKYSTPITSNTGNQAPTGEGRALGKSNSIKVK
GESGKSSRDVRLAKREDNIAQTGGKMCQKINLDEAEEFFDLISKVQSNRADDQRGVLRRE
DLVLPEFLHLPSSGAGSSSFIPEGTKGCSKRSEPPEVRDRHTQLGGKVGFMKNCSEVSAT
KINISESKQKPPVLAKSLSQKTFSTPFSPPLSPVLPLQDAPIWKRQSKELQKEGVETVED
ENVADLTLVAEGDINSPNSTLLPPSSPSPPLSSPTSDKSTLAEARYPPPVLLTDNQKKTT
YEKCKTGGEQKVWTGNKRSQE
Download sequence
Identical sequences H9GAK2
ENSACAP00000005660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]