SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9GF99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GF99
Domain Number 1 Region: 300-352
Classification Level Classification E-value
Superfamily RING/U-box 8.95e-17
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Weak hits

Sequence:  H9GF99
Domain Number - Region: 7-16,46-62
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000811
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9GF99
Sequence length 359
Comment (tr|H9GF99|H9GF99_ANOCA) Ring finger protein 215 {ECO:0000313|Ensembl:ENSACAP00000009302} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN=RNF215 OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
APRARRPPPPPPPPPPRPWPCAAPGSPPRSSSPTEPRRRPPSGAAWSWDVPEWLPQTSWV
EKGWSERAPGQLIGWWRPSFPQVGDADPKVEEEDAWIGVVPVGEDQAEAPRCVAKEESFT
SAVVSKMKRALVLGASALLILALNQNALRELDVSQVLSKPVVLVQTSENVTKLFGALLRG
LRATAKITYQAVLLENVGVTLTLWSTCGLSRGGLYGEWQGVICTGENSSRVQKYLQQLWN
AILLIALILCTGLILQAQRQSRHGQREQDPEPDLKQHVARRLSALKTRRYHPPGKLPRSW
AHEIDCCAVCLDQFHKNQCLRVLPCLHEFHRDCVDPWLLLHQTCPLCKHNILGNCFQES
Download sequence
Identical sequences H9GF99
ENSACAP00000009302 ENSACAP00000009302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]