SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9GK63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9GK63
Domain Number 1 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-64
Family Ubiquitin-related 0.0094
Further Details:      
 
Domain Number 2 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.33e-64
Family Ubiquitin-related 0.0094
Further Details:      
 
Domain Number 3 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.33e-64
Family Ubiquitin-related 0.0094
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.21e-64
Family Ubiquitin-related 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9GK63
Sequence length 304
Comment (tr|H9GK63|H9GK63_ANOCA) Uncharacterized protein {ECO:0000313|Ensembl:ENSACAP00000013468} KW=Complete proteome; Reference proteome OX=28377 OS=Anolis carolinensis (Green anole) (American chameleon). GN= OC=Toxicofera; Iguania; Dactyloidae; Anolis.
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGG
Download sequence
Identical sequences C1L939 H9GK63
ENSACAP00000013468 ENSACAP00000013468 5b83_A 5b83_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]