SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9H6K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H6K9
Domain Number 1 Region: 101-379
Classification Level Classification E-value
Superfamily L domain-like 2.13e-45
Family Ngr ectodomain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 395-698
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.12e-42
Family Rhodopsin-like 0.0013
Further Details:      
 
Domain Number 3 Region: 26-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9H6K9
Sequence length 714
Comment (tr|H9H6K9|H9H6K9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000015860} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
QTASDSWVPLFPLEILLILGLVESSSHHTCPPGQFPCGNTSVCLPQVLRCNGHPDCANGA
DEENCEDNSGWLNLLDLIQRTKGSQTKTREQLKDCSLGLYPKGCKCSWRVVDCTAQGLSG
VPPAPDPNNVSLLNLQKNQLHQLQDKQFIGFQSLEGLFLQNNDLHSIAPGAFAGLSKLRK
LFLSHNRIRSLPPRLFQDLFQLEWLMLDNNQITDLSPDSFLGLKSLYFLFLPGRDAQRLP
PTPPSSDPLLLPGSHLSNGAGIRYPHCQNQILQGNLIKAIQEGTFANLPQLVELDLSCNL
LKEMPPSMYQGLQDLQMLNISANPLKELPVDHFDSLPYLQSLSMEGMEISNIENRMFQKL
TNLSYVYFGHFQYCSYVPHVRNCQPNTDGISSLENLLANLILRIFVWVIACTTCLGNLLV
VCMRSLIVPENFQHAMAIKCLCCADFLMGVYLFFIGASDLRYAGEYNKHAQAWMASPQCQ
AGGCLAMLSSEVSVLLLTYMTLEKYVGIVFPFSHYRAGRRQTLATLVGIWLVGFTIAVVP
FWSRGPFGNYYGTNGVCFPLHFDTSESAMAQHYSTAIFLGVNLIAFITMVVAYSSMFHAV
RVSRARSAQHLSREVSIAKRFFFIVFTDALCWLPIFLLKLLSLLQLEIPGAVTSWVVIFI
LPINSALNPVLYTITTSPFQERLKQCLQREGRSVPSSQSAGPSFTLVPLQATSA
Download sequence
Identical sequences H9H6K9
ENSMODP00000015860 ENSMODP00000015860 13616.ENSMODP00000015860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]