SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9H6W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H6W2
Domain Number 1 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 57-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-26
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 383-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 2-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000742
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9H6W2
Sequence length 435
Comment (tr|H9H6W2|H9H6W2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020581} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
RKNPYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKRIHTDEKPFQCHDCGKAFNQ
NSHLLQHQRIHTGEKPFKCDDCGKAFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRTFKQ
SSHLLQHQRIHTGEKPFQCHDCGKAFNQNSNLSVHQRIHTGEKPFQCHDCGKAFNQNSHL
LRHQRIHTGEKPFKCNDCEKAFNRSSHLLQHQRIHTGEKPFKCNDCEKAFNRSSHLLQHQ
RIHTGEKPFKCDDCEKAFNRSSHLLQHQRIHTGEKPFKCNDCEKAFNQSSHLLQHQRIHS
GEKPFKCDDCEKAFNQSSNLLQHQRIHSGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKP
FKCNDCEKAFNQNSHLLQHQRIHTGEKPFQCHDCGKAFNQSSNLLKHQRIHTGEKPFKCN
DCGKAFNRSSNLIVH
Download sequence
Identical sequences H9H6W2
ENSMODP00000020581 13616.ENSMODP00000020581 ENSMODP00000020581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]