SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9H6X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H6X3
Domain Number 1 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 129-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.98e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 479-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 74-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 31-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000032
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 176-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000243
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 10 Region: 260-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000042
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 11 Region: 344-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000083
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9H6X3
Sequence length 543
Comment (tr|H9H6X3|H9H6X3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020604} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKTNSVEKSEKPGVTFGAFHLYSFQKSTNMYTGEKFYKCPQCRKAFNKSSKLILHQRIHV
GENLCECNDCGKGFHHRSKLNIHQRAHTRKNPYQCNDCGKMFINDSKLILHQRIHTGEKP
FKCNDCGKVFSHRSKLIIHQRIHTGEKPFKCDDCGKAFNQSSHLVQHQRIHTGEKPFQCH
DCGKAFNQSSHLLQHQRIHTGEKPFQCHDCGKAFNQNSNLSVHQRIHTSERPFKCNDCGK
AFNQSWHLLQHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRVHTGEKPFKCHDCGKAFIR
SSNLLQHQSIHTGEKPFKCDNCGKAFNQNSNLLQHQRIHTGEKPFKCDDCGKAFNQNSHL
LKHQTIHTGEKPFQCHDCGKAFNQNSHLLRHQRIHTGEKPFKCNDCDKAFSQRSKLNIHQ
RIHTGEKPFQCHDCGKAFKQSSHLLQHQRIHTDEKPFKCDNCGKAFNQNSNLLQHQRIHT
GEKPFKCDNCGKAFNQNSHLLQHQRIHTGEKPFKCNDCGKAFNQSSNLIVHQRIHTGKLV
KKS
Download sequence
Identical sequences H9H6X3
ENSMODP00000020604 ENSMODP00000020604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]