SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9H8J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9H8J7
Domain Number 1 Region: 291-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-37
Family Laminin G-like module 0.000000415
Further Details:      
 
Domain Number 2 Region: 71-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-31
Family Laminin G-like module 0.00073
Further Details:      
 
Domain Number 3 Region: 13-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000028
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9H8J7
Sequence length 530
Comment (tr|H9H8J7|H9H8J7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000027121} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MFSWLRGGLFGNNPCLPNPCHHGATCQAREADMFHCQCPKGREGPTCADERNPCQPNPCQ
GAATCRVLPEGGAKCECPMGRGGQFCQTVTEQDPSRPFLPNFNGFSYLELKGLHTFGDVR
GEKMAMEVVFLAQSPRGGLFYNGQKTDGKGDFVSLALHGGHLEYRYDLGKGAAVIRSKEP
IALNKWTRVSLERNGRKGAMRVNDGDRVLGESPKSRKMPHTVLNLKEPLYVGGAPDFSKL
ARAAAVSGGFDGAIQLVSLKGRQLLTRENVRDAVEISSFPDHPCTQASGQPCLNGGSCSP
QQDTYECLCLGGFSGVHCEKGLIEKSAADLDSIAFDGRTFIEYHNAVTTSELTNEIPAPD
AMDSGVLPSEKALQENHFELSLRTEAMQGLVLWSGKGTERADYIALAIVNGRLQMTYDLG
SQPVVLHSTVPVNTNRWLRVKASRVQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGG
LEKLTVAHSLPKAYSTGFVGCLRGVVVGQKELHLVEDALHKPTLRHCSAP
Download sequence
Identical sequences H9H8J7
ENSMODP00000027121 ENSMODP00000027121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]