SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9KVT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9KVT6
Domain Number 1 Region: 260-330
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.09e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H9KVT6
Sequence length 616
Comment (tr|H9KVT6|H9KVT6_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000004381} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
EMLQFVSNQVGEFPDLFSEQLCSSFPGSGGRAVDPAMPRSFSQVPLPSFSPSAASPQAPA
LQVKVSPTSVSTTPRATPIQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQS
LVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQI
IKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSNGTILTTMPVMMG
QEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKS
GVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSEVDLKIEDFNQN
VLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVL
TFLCLSFNPLTSLLQWGGAHDSDQHPNSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGV
IVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLSREVYGKDSESTYSIEELNIHI
SGGTRTRTLLSSRRFCSCCRQPANLPGSFGPGTAHLPPGPGLQPLLERDPLQPAEATPGA
LAAQESFPAPAGHTSD
Download sequence
Identical sequences H9KVT6
ENSCJAP00000004381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]