SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0GP84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0GP84
Domain Number 1 Region: 1-395
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.92e-38
Family Phase 1 flagellin 0.00015
Further Details:      
 
Domain Number 2 Region: 353-634
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.57e-28
Family Phase 1 flagellin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0GP84
Sequence length 635
Comment (tr|I0GP84|I0GP84_SELRL) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=927704 OS=TAM6421). GN=SELR_08630 OC=Selenomonadaceae; Selenomonas.
Sequence
MSMVVKNNIPAVMTLGVLNKNSAALAKSLQQVSSGMKINSAADDNSGFAIAERMQVRIRS
LDQADQNTQSGASMLKVAEGSVNSTIDILRTMKEKAINAANDTNTDTDRGIIQKELDQFI
DQVDDNALITYNGKTLVDGSKMSKGDATRTALTNESLNSKTTGLTALVDLQNRNGENLNI
LTTDKLTVSYVIQGRNYSKEIDIDVNKTLNDVLVEAMEPYSSGSDNPQLRAAYDNYNSSV
GVANSAYNSSVGAANSAYNSSVGAAASAYTLITTTGGTVSTATGETTLVAAMSMATSAIT
VNQDVYSRNLSRYNDASTNLASATPGSADYLDYSDQVSMYSTRLASYSAAISTDTSTYNA
LSTQLGSVIASAYTVYSTAESTAASTLAVAKAAATSTLNSAINAAVEALNGDLEAIGDLI
PYQLTMKASNVVGQDAAGNDVYTADMGTALTITAAGAGDKYQLSGFTFNVTDIDGNIKKN
VNSVLDNFTESVRALNKSEDNSITFQVDAKANQAIKIGLTDMRSEALGLKGANGETLSIA
TQKSANSAVNVLDNAIKKALDQQTDIGAISNRLGQTSANLRIARDNVQASESTIRDADMA
KVMTEYTKNNVLLQASQSMLAQANQSGSSVLGLLS
Download sequence
Identical sequences I0GP84
gi|383753691|ref|YP_005432594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]