SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0GP89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0GP89
Domain Number 1 Region: 1-188,303-341,404-589
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.57e-66
Family Phase 1 flagellin 0.00022
Further Details:      
 
Weak hits

Sequence:  I0GP89
Domain Number - Region: 237-379
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0235
Family Reprolysin-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0GP89
Sequence length 589
Comment (tr|I0GP89|I0GP89_SELRL) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=927704 OS=TAM6421). GN=SELR_08680 OC=Selenomonadaceae; Selenomonas.
Sequence
MTMVVKNNMTAIRSLNVLNHNSNELAKQLQQVSTGMKINSAADDASAYAISERMRVNIRG
LSAAYSNTQNANSMMKVAEGAISSTVDILKAFKEKALDAANDTNTDVDRAIIQNQLVQYM
SQIDDNANVTFNGKYLLNGTMGSNIVANQHDAIVSFMSYLNDSNLPASDALDAAINYTSC
GMFKDEKSLIDSFLADVKEHGLTACGIDLRNDDTGAITGQDANGDRPKTAESIVPETGNP
YASSPSGSTIIRGLAVNWPDTGNDAMKAAIVSALDNEWLGNCMDLIDESYALNFQENGTS
VRSMNVNFTDANDGTLAFVTSHFNGNGVTTGLDLTVNMHYYNNLDLSDHNGAVAGQPNQL
YLDRTIAHEMTHALMSANINNFSNLPLYIKEGAAELVHGIDDYRKSKIEALAADTDTLRS
VLEDSEHAEGDSAYAAGYMILRYLANKSADTDPEKHISFQIGTKANQAIRMGLADMRCES
LGLKKGDGTTVSVVTQTKANSALTVVDRALDRAIKQQITVGAIQVRLNYAAANLNTAHEN
ITASESTIRDADMAKTFTSYTRANVLMQTSQSMLAQANQSSSNVLGLLQ
Download sequence
Identical sequences I0GP89
gi|383753696|ref|YP_005432599.1| WP_014424015.1.93961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]