SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0HIK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0HIK0
Domain Number 1 Region: 94-469
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0000000000000017
Family Phase 1 flagellin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I0HIK0
Sequence length 476
Comment (tr|I0HIK0|I0HIK0_ACTM4) Putative flagellar hook-associated protein {ECO:0000313|EMBL:BAL92837.1} KW=Complete proteome; Reference proteome OX=512565 OS=/ JCM 3121 / NCIMB 12654 / NBRC 102363 / 431). GN=AMIS_76170 OC=Actinoplanes.
Sequence
MGSTFSGLNTALTSLYAQRRGLDVTGQNIANASTEGYTRQRVVMQSQNANLVPGVYATTT
AVGSGVTVSSVERLRNTALDQRSYTEHANSAYHNERASSYALIEDAFAEPSDTALQARLQ
DMWDGWNAVSTNPDKAAPKAAMIQQATTVAATLNDASAQLNNQYQATRAGLDTYVGEVNK
AAETIARLNQEIVVATAAGLQANELQDQRGQAVLKLSEMVGATATDLPNGALSVYVGSAP
LVSEFTTRPIEIEAGGALRLEDLGTTEVNLRFTDTKSPVSPGGSMGAAMEMLARGGTLQT
MSERLDKVATTLAKTVNDIHKLGYSIDGTGPGENFFVAGNANPLSAANITVGVTDPDKLA
ISSGDPTLDPGGVLDGVIADDISELSTSRTGADAEYQSLIGDLGVAAQSSIRRRDIQNAV
TDQVDAARDAESGVNLDEEMTNLLTYQRGYEAASRVLTTIDSMLDQLINRTGLVGR
Download sequence
Identical sequences I0HIK0
gi|383782786|ref|YP_005467353.1| WP_014447720.1.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]