SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0HIK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0HIK2
Domain Number 1 Region: 1-411
Classification Level Classification E-value
Superfamily Phase 1 flagellin 9.15e-91
Family Phase 1 flagellin 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0HIK2
Sequence length 411
Comment (tr|I0HIK2|I0HIK2_ACTM4) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=512565 OS=/ JCM 3121 / NCIMB 12654 / NBRC 102363 / 431). GN=AMIS_76190 OC=Actinoplanes.
Sequence
MGLRINQNIAAQNAYRNLSVTDNQMSKSLEKLSSGFRINRAADDAAGLSISEGLRSQVGG
LKVAVRNAQDAISVVQTAEGALNETTSMLQRMRDLAVQANNASLDAEAKNAAQAEFSQLR
SEIDRVSDTTSFGKSKLLDGSFGNTQGLSTASPAVLADGDALGIKIDELNGVDVSALDIK
ASVTASVNTPAEAGDTTMDSAVADMNKQLSDALKTAGYNGDEITVSAKMDADKKITWQVN
SAGGQTFKTDGTDTTIVAASTSSAARTGATPGDFQIGANADEKLNISIGAVNSQSLGLRG
LDLTTAGTAASAGVDAVPSGAEAAITALDKAITTVSDQRAKLGASQNRFEHTINNLNTAV
ENLSASESRIRDTDMAQEMVSFTRNQILTQAGTSMLAQANQSSQGVLSLLR
Download sequence
Identical sequences I0HIK2
gi|383782788|ref|YP_005467355.1| WP_014447722.1.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]