SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0HLF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0HLF6
Domain Number 1 Region: 4-276
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.49e-89
Family Methylenetetrahydrofolate reductase 0.000000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0HLF6
Sequence length 280
Comment (tr|I0HLF6|I0HLF6_RUBGI) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=983917 OS=Rubrivivax gelatinosus (strain NBRC 100245 / IL144). GN=RGE_04980 OC=Rubrivivax.
Sequence
MSTTPVSFEFFPPNTPVGADKLRTVVQDLAAVKPEFFSVTYGAGGTTRERTLETVKAIAA
MGHEAAPHLSCVGSTEANIAEILATYRQQGIRRIVALRGDLPSGTATAGEFRYASELVEF
IRRTQGDDWFIEVAAYPEYHPQQRYARRDLEHFAHKVRAGANSAITQFFFNPDAYFHFVD
EVHKLGVRVPIVPGIMPIHNYARIAQFAARDGIEIPRWVALKMEGFMDDAASVRAFGVEV
VTRLCERLIAGGAPALHFYTLNQSALSLEICRKLGLAQAD
Download sequence
Identical sequences I0HLF6
gi|383756357|ref|YP_005435342.1| WP_014426719.1.89159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]