SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0IQ14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0IQ14
Domain Number 1 Region: 17-254
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-29
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0IQ14
Sequence length 269
Comment (tr|I0IQ14|I0IQ14_LEPFC) Putative proline dehydrogenase {ECO:0000313|EMBL:BAM07363.1} KW=Complete proteome; Reference proteome OX=1162668 OS=Leptospirillum ferrooxidans (strain C2-3). GN=LFE_1683 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Leptospirillum.
Sequence
MSDSLFSKNIEMLYLAGETRQEALDRAKLLNKEGIGTILWPILSEENDSDGELFLKEIRE
LSHQMGLTMIRGGISFSLSQSGYPSSNGSMDHLRSAIAAAEDYSIGCWIDMEEGERVSET
METFLELRKKFAHLSITLQARLDRTEKDLETILNKRARVRLVKGQYPVSLESGSNDPDQI
RRKYLSYMEWLFSEGAMFAVATHDEEILQGASRLQNAHPRMMEFQMWLGMREDRIRSLLF
EGGFPVTLVLPYGPGARKHLKALQEIGKI
Download sequence
Identical sequences I0IQ14
gi|383784923|ref|YP_005469493.1| WP_014449848.1.71101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]