SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0KGW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I0KGW0
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.02e-48
Family Molybdopterin synthase subunit MoaE 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0KGW0
Sequence length 136
Comment (tr|I0KGW0|I0KGW0_9BACT) Molybdopterin-converting factor subunit 2 Molybdopterin synthase subunit 2 {ECO:0000313|EMBL:CCH03363.1} KW=Complete proteome; Reference proteome OX=1166018 OS=Fibrella aestuarina BUZ 2. GN=FAES_5364 OC=Fibrella.
Sequence
MIALTADPIDFSSAYHYLQTDEAGAIDFFFGVVRNNTQKRDVQQLDYEAYGPMAVREMQK
IADEACRRWNVLRYVIIHRTGVLRIGEMAVLIGVATPHRDAAFEATRYIIDTIKQTVPIW
KKERFTDGEVWVNATP
Download sequence
Identical sequences I0KGW0
WP_015334460.1.89626 gi|436838740|ref|YP_007323956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]