SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GQ93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GQ93
Domain Number 1 Region: 17-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-21
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 335-422
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-20
Family B3 DNA binding domain 0.0058
Further Details:      
 
Domain Number 3 Region: 544-646
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-19
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1GQ93
Sequence length 649
Comment (tr|I1GQ93|I1GQ93_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI1G14510.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100826730 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MCCERCKRRDERDYCSLDDREKYFLIFMEDGCAHEMIVPNEFVRRFSGEIPGEIELETRN
GQTYTVGVSKYPDKLVLTAGWGAFVKTYDLQIGDSVVFRYDGDSQFNVIVFDRFGREKAS
SVVAVADNDPLSPHEQEKNRVSTESLNRSHSYPQRMEVQSPTENVNRSQGHPQAMQMPSP
TENVNLSQEHPQPMQMPPPTENMDRSQRHPQPMHMQSPTGNVDGFVGLSRHMEVQSPTEN
VNSFVGHSEPTQMQPPTDTMNHCSYHPQTVQMQLSCSHTERQSKLQNDYSNQGDSLPPED
DIEVCEEPRYMLGRKNRLSSAQVKEVDEMVQHIHHENPIFVAVMSKCNVTGSFHLSVSKQ
YVKRYMGNKVRCICLQRCGKKWEVHFGGRPGEKRIVAGWRKFVKDNDLEIGDICIFELLK
NYMMCTIEVHIIHIKDLDSSSQNGCNKVKRSSKIVACSHSRPELVPTQTMKHSMVRPQST
QTQSPPIKRKMPLQRVKTLGRERDSLFSEDSNGDVDTLTDYIAVHKKRLTPIQKREVKKM
VQSIDSEIPIFVVVMHKTNVTRRFTLSISKKYAEKYLGGEVQRIWLERLGERCQVNLGRR
PQDTRVVGGWAKFVRDHEVEVGDICLFELLKNRVSCTMKVHIIRAKNVS
Download sequence
Identical sequences I1GQ93
EG:BRADI1G14510.2 XP_014752327.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]