SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GQ95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GQ95
Domain Number 1 Region: 22-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 458-565
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-20
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 3 Region: 248-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000235
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1GQ95
Sequence length 568
Comment (tr|I1GQ95|I1GQ95_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI1G14530.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100836815 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MARLESQVQKSCDCCKTYVGHLEGKMKCFQRHMTADFRHGMIIPNKFMDHFGGKISRTIE
LESPDGNTYVVEVSKNLSKKSPCHGWEAFLDAHHIEENDSLLFRHIKNSRFEVLVLDSDD
CEKVFSCVGIKVTCNVQERSSDYDDISNSSYADTTKSSGSKEFASCERVHSSHPRKTAKT
PAKYSSSEDSDAGEDTEDICSEYESSFQLDDLQTPLGCDYVLCHRSAQPGVHEEKVTRLL
QDKDIRAEAPLLVAIIRQSNLKSRSSGLVIPKGYAAEHLPHKSQTVILQRPGKNKKWYHR
FHIRKDGCAFLRLLGFLRDNQVQEGDICVFEPMKGTGKKFSLKVHLLRESIHGGSGTGPK
RVSSPHGKSRVSSATHIRISTTHGRTRANATPKTRVKEELDHGRSHPYSGSNHGHRAHKQ
PLESDEYEEPVERPYMLSDIACLTWEQEKKVKRRVDAIQSEVPIYVSIMNNSSVGANRLY
HLTIPKKYAAKYLPAGGHTLRLLRPERSKTWDVEMHPRVGGAKMLRGGWHEFANENRLQV
QDLCLFQLMKNERRLTMMVYIIRHNDKR
Download sequence
Identical sequences I1GQ95
15368.BRADI1G14530.1 EG:BRADI1G14530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]