SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GRL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GRL1
Domain Number 1 Region: 190-383
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00072
Further Details:      
 
Domain Number 2 Region: 24-140
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-17
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1GRL1
Sequence length 862
Comment (tr|I1GRL1|I1GRL1_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK14864.1, ECO:0000313|EnsemblPlants:BRADI1G19100.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g19100v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAAAAVAERQQQQRGGAAAAAAASGGAVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVF
FKSDPNTLPQRGGEVNLTLGGIDLNSSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSE
DLFEWKIALEEALALAPNAALVMGHNGIFRNDTTDAYEGAAPNLREKRPTKSLVVGRPIL
LALEDIDGSPSFLEKALCFLEKHGIKVEGILRQAADVEEVDRRMNEYEQGRTEFAPDEDA
HVVGDCVKHVLRELPSSPVPASCCTALLEAFRLESKESRINSMRAAISETFPEPNRRLLQ
RILRMMHTVASHTTNNRMTPSAVAACMAPLLLRPLLAGECEMEDDIDMNGDNSAQLIAAA
IAANSAQGIVTTLLEDYEGIFDDEHPRCSLSPDSRIQDSGSEESTDDETVDAKENGFHDA
ENDVDQELDERILSGKLSESSACIGGDLYDYQVDHGDSDTEPYVEDKEANLDLKDAPNSH
LAQNGKINVQRPLNEKDPTNLVSSHESPLSVGEILSSLDAGVRLPGPGAEYSVDSHSIKS
NETQLHVKRSNIWGRNNARKSQQTEFVDSSGEEELAIQRLEIAKNDLQIRIAKETRGNAI
LQASLERRKQALHERRLVLEQDVSRLQEQLQAERDLRAALEVGLSMSSAQFSSSRAMDSK
TKAELEEIALAEADVARLKQKVAELHVQLSQQRQHQYGSSGDENDRYQHRPSHLPQNFVQ
PGFDMKLASCNQEKKQRHEESLSGASHWRSIKQHVLTHGSSKPFSRKHSLDASSSDSREA
STSMAAESGLMSSNIPRATEAVEYGRQLPVPSSTLVELTTRLDFFKERRSQLMEQLHSLD
LGHGSAPHGFPYKPSPPWNSQR
Download sequence
Identical sequences I1GRL1
XP_010234543.1.954 EG:BRADI1G19100.1 15368.BRADI1G19100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]