SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GUW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GUW2
Domain Number 1 Region: 934-1201
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-78
Family Protein kinases, catalytic subunit 0.0000158
Further Details:      
 
Domain Number 2 Region: 183-272
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.16e-22
Family PB1 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1GUW2
Sequence length 1219
Comment (tr|I1GUW2|I1GUW2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK16477.1, ECO:0000313|EnsemblPlants:BRADI1G28950.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g28950v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MEPRKDDVLSKAQSTVHGSPSSSSASTSSPVPEYPATSTTKPVLNFSIQTGEEFALEFMR
DRAISKKHLVPVMPRDQNAASVADLKSSRGILGAHRTGAESRFDASIFLTTDNQQPDELE
RRSFAENENRSRHISTRSVPRAPSSGGSSHGLAHGYASSGASDTSRRIKILCSFGGKILP
RPSDGKLRYAGGETHIIRISRNISWQELKQKTTAIFNQPHIIKYQLPGEDLDALISVSND
EDLRNMMEECGFLDSGEGSQKLRIFLVSSIDFDDMNFSLGSMDSDSGIQYVVAINGMDVG
AAKTSSGHGLVNTSINEFGQFINFNVDSTPADLRKTGSNLHSLNESTSVPPAIMSRPVPV
GLSSDNTATLHSYPNHGIQHVHGSDFSYPTSSEQFHDSEGQMSIPLSTPSDFRYTSQYAP
YSGTASLQSFEQQSYQDGMAVGSVKKEKRDSVKMPLQNNGLDYFRSLENLSAPMLDHESS
ALKYMHSELPATSSVQEGLASSVHPSYSVKSLETYTASKTMSPTQASECNEDDRQSSEAF
ASGCSEFQVDMSDHSNKNSPPHPGRVFHSEWIPREQAGFLNRLSKSDDPLNSQILILQSQ
SGVANESIAEAIDPAVEGTEKSNLATWALNLNDPITDDSLIQFGKEYVNTVQQTSPFNEQ
LFGETMSSNDTCMHVAEKIVVKGKVTEATTDGIEATNLRGDQVAMPHSWDAPKPAFSTDV
ESDPVVSCSTSTVDDSRKEHIIPKTHDKDVAGCTGPTGERSSPDILSDFFAKANTAAQSP
HPLNDPILSLNMPNYEPQRWSFFRNLAQNEFQHKDRDKDLAKIEEGSYPFAHLEHDMVNV
KNFPPQDVIHVGTHSVPSSTNVDSTILPPTFIPSQTDNPPMMKTVEGFQVDNPFTNMREM
IPSVPEFEEPKFEESRAVGPVMDASFVDNDFEYLQIIKNEDLEELRELGSGTFGTVYHGK
WRGSDVAIKRIKKSCFTGRSSELERLANEFWREAEILSKLHHPNVVAFYGVVKDGPGGTL
ATVTEFMVNGSLRHVLQRNKNLDRRKRLIIAMDAAFGLEYLHSKNIVHFDLKCDNLLVNL
KDQSRPICKVGDFGLSKIKRNTLVSGGVRGTLPWMAPELLNGGSNKVSEKVDVFSFGIVM
WEILTGEEPYANMHYGAIIGGIVNNTLRPHVPASCDPEWRRLMEQCWAPDPAQRPAFTEI
AGRLRSMSVAASQVKATSK
Download sequence
Identical sequences I1GUW2
XP_010238974.1.954 EG:BRADI1G28950.2 EG:BRADI1G28950.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]