SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GXH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GXH6
Domain Number 1 Region: 9-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-90
Family Protein kinases, catalytic subunit 0.00000663
Further Details:      
 
Weak hits

Sequence:  I1GXH6
Domain Number - Region: 380-417
Classification Level Classification E-value
Superfamily KA1-like 0.0118
Family Ssp2 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1GXH6
Sequence length 446
Comment (tr|I1GXH6|I1GXH6_BRADI) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00351747} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g36520v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAGAARKKLVGRYEVGRTIGQGAFAKVKFAVDSDTGAAVAMKVLDKATILNHRMMHQIKR
EISIMKIVRHPNIVRLNEVLAGQTKIYIILELITGGELFDKIARQGKLRENESRKYFQQL
IDAIDYCHSKGVYHRDLKPENLLLDSHGNLKVTDFGLSTLSQNGFLHTTCGTPNYVAPEV
LSKDGYDGSAADVWSCGVILYVLMAGYLPFEENDLPTLYDKITAAHFSCPDWFSSGAKSL
IQRILDPNPKTRMTVEGIRADAWFKNNYVAHKRGEDENVCLDDVQAVFDNIEDKYVSEQV
THNDGGPLIMNAFEMITLSQGLDLSSLFDRQQEYVKRQTRFVSRKPARTIAATIQVVADS
MGIKVHSYNYKLRLEGVSSNKMSPFAVVLEIFEVAPSLFMVDVRKVAGDTLEYHRFYKNL
CSKLESIIWRPIEVSAKSALLRTTTC
Download sequence
Identical sequences I1GXH6
EG:BRADI1G36520.1 XP_003563655.1.954 15368.BRADI1G36520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]