SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GYP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1GYP3
Domain Number - Region: 431-524
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0139
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1GYP3
Sequence length 561
Comment (tr|I1GYP3|I1GYP3_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK18445.1, ECO:0000313|EnsemblPlants:BRADI1G42520.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g42520v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAMATATSYTLRHTPPSPPPRLHAPLLPQLRRRATAKVAASWVTAGGGNSDDGLGGWWLP
EQTVEHRRAGFGRALAVGLGTSAAIALAGITWNSPSSRKCLQQLIDVPVRYVQEKFSLSE
SAEIPKDEAIVKESDAIDVLGITVDENSDASTDDSSRHRIPARGDRVSCRIPADPMHEES
LSILKKLQIIENDAGSSEFCTRREFARWFVKLCSRLERKRRHRIIPNLLICGSVESAFDD
VNLDDSDFLYIQSLGESGIVPSKLSSFCGTFTSDSLSANRNANFQPDSYLSRLDLVNWKV
LVEHPFASELDQKMPSKNVHTLDLSAWPDVSASILTDLIGGDHSIISKVFGNTRRLQHHK
PVTKAQAAAALTSGRMEEVIRDELKRLEVENESRLSVMGEMMEELIERGDIRQYWDCKMK
REQDCGLEVEKHLQDVFHELANERTDREKELAVLLKERTALEHQNQELVSLRSEVDSMYD
RLANESIEIMADEQNLEKLSSDMSSKHQAVTEAKSYLEAEKEALTMLRSWVETEAARVHE
RAKVLEKAVRRWRIPADSDCN
Download sequence
Identical sequences I1GYP3
XP_003563888.1.954 15368.BRADI1G42520.1 EG:BRADI1G42520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]