SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GZ13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GZ13
Domain Number 1 Region: 315-481
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.21e-43
Family Retroviral integrase, catalytic domain 0.0041
Further Details:      
 
Domain Number 2 Region: 690-912,940-1124
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-29
Family Reverse transcriptase 0.012
Further Details:      
 
Domain Number 3 Region: 39-75
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000331
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1GZ13
Sequence length 1174
Comment (tr|I1GZ13|I1GZ13_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI1G43550.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MRQRDHDGSGGSNSSGNRRQKKPRGRTADATRGKDAKEEHGSGSATSGATRNDQCRYCGK
MVHWARECGKKKREEAHLVQADDDAPALLMAQVSSVMEEPEMIHGEVYLNEERAKVRLGP
EWEPVEVPWYLDTGASNHMTGDRKMFADLDEGIIGSVKFGDNSVVGILGRGTVMFAMANG
EHRALGDVYYIPRLKTSIISLGQLDENGCPTAIRSGIMTVRDRREQLIAQVPRLPNRLYR
VSLQIVMPVCLSARSGDAGWLWHERLGHQHFGALQKMSSSGMVRGLPHIKHVNQLCDACL
AGKQRRSPFPQVGKFRATERLELVHADLCGPISPPTPGGRRYFLLLIDDVSRYMWLVLLT
AKDESEAGIRRVKAVAELESGCRLRVLRMDNGGEFTSNAFNDYCADAGIKRHHSAPYTPQ
QNGVVERRNQTVVSMARSMLKARNMPNSFWGEAVTTAVYVLNRSYTRAVDGITPYEAWHS
KAPTVEHLRVFGCVAHVRSAKPHLKKLDDRSSRMVFIGYESGSKAYKVYDPMSRRVHVTR
DVVFDEAASWNWAGTDDVARQGELTVEFSTDASPSGGIAAPAPTKGIGMPPTPLSPPRPA
TPSSSASSPEPSTPASPAPMFVSPPASVTPTSADGDPPARRYRLLDDVHADLDHELNLAA
SEEPTTFAEAEPHHGWRAAMLDEIKSIEENGTWQLVDLPAGHRPIGLKWVYKLKKNAAGD
VVKHKARLVAKGYVQRAGVDFDEVFAPVARLDSVCVLMALAVQLKLEVHHLDVKSAFLNG
DLEEEVYVVQPVGFVDEAAPDKVLRLRKALYGLRQAPRAWNAKLDCTLLSLGFQRCPSEH
AIYVRGSGEDQLLLGVYVDDLIVCGASQQGIQNFKQQMQSSFKMSDLGRLTYYLGIEVKQ
TPGRITLCQSGYATKLLEKAGMGNCNPVHVPMEHRLKLSKVSLNPPTDATLYRSIVGSLR
YLVHTRPDIAFAVGYVSRFMEHPTTEHYGAVKHLLRYIAGTKSYGCVFSFSATGNNLTGY
SDSDMAGDVDDRKSTTGVLFMLGGNSITWQSQKQKVVALSSCEAEYIAATTAACQGVWIG
RLLGELLDEKSGVATLYIDNKSAIQLCKNPVFHDRSKHIETRFHFIRECVDDGRISVESI
GTEDQLADILTKSLAKVKFQELRRRIGVMDLASN
Download sequence
Identical sequences I1GZ13
EG:BRADI1G43550.1 15368.BRADI1G43550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]