SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1GZX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1GZX5
Domain Number 1 Region: 481-540
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.72e-18
Family SPT5 KOW domain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 1000-1042
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000292
Family Ribosomal proteins L24p and L21e 0.054
Further Details:      
 
Weak hits

Sequence:  I1GZX5
Domain Number - Region: 431-467
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000426
Family N-utilization substance G protein NusG, C-terminal domain 0.053
Further Details:      
 
Domain Number - Region: 727-764
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0117
Family Ribosomal proteins L24p and L21e 0.05
Further Details:      
 
Domain Number - Region: 612-638
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0142
Family N-utilization substance G protein NusG, C-terminal domain 0.033
Further Details:      
 
Domain Number - Region: 279-325
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0305
Family Ribosomal proteins L24p and L21e 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1GZX5
Sequence length 1053
Comment (tr|I1GZX5|I1GZX5_BRADI) Transcription elongation factor SPT5 {ECO:0000256|PIRNR:PIRNR036945} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g46230v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MARRGRDEDDDEVEEEEDEEEAYDLDEEEDEEDDYEEEARGRGKAAARSRGSGGGGGSGG
RKRSRQDNFIDDSAIEDDDEEDEDDDGGGRPRKKGGGGVRGFFDEEAQVDEDEEEEDEGE
GEDDFINDAGADIPDDDAARGSRSRHSIPMRDEEEDIEEIERQVRERYARSTHIEYGEEA
ADVEQQALLPSVKDPKLWMVKCAIGHERETAICLMQKFIDRTDLQIKSVVALDHLKNYIY
VEAEKEAHVKEACKGLRNIYASAKITLVPIKEMADVLFVESKTVDLSRDTWVRMKLGVYK
GDLAKVVDVDTVRQRVTVKLIPRMDLQALASKLEGREVVKKKTFVPPPRFFNIDEARELH
IRVERKRDKDSGEYFEMVDGLMFKDGFLHKTVSTKSIHTQGIQPTFDELEKFRKPGDDMN
GDMASLSTLFSNRKKGHFMKGDAVIVIKGDLKNLEGWVEKVEDTTVHIRPKLSDLPKTLA
FNEKELCKYFKPGDHVKVVSGVQEGATGMVVKVDGHVLIILSDTTKEHIRVFADHVVESS
EITTGITRIGDYELHDLVLLDNLSFGVIIRVETEAFQVLKGMPDRPEVVMVKLREIKSKI
DRRASAQDKSNNMISTKDVVRVVEGPCKGRQGPVEHIHKGILFIYDRHHLEHAGFICAKA
KQCLLIGGSNGGRRGNGMDAADARLGALRTPASILQSPGKLPPRGPYMNSGGRFGGGGRG
GRGYDALVGKCIKIKSGPYKGYRGRVKEVTGVLVRVELDSLMKIVTVKREDIADTPTVAT
PFREPRYSMGGETPMHPSRTPLHPFQTPMRDPGATPIHDGMRTPMRSRAWAPMSPPRDNW
EDGNPDTWGSSPAYHPGTPPARPYEAPTPGSGWANTPGVSYNDVPTPRESNYGNAPSPYV
PSTPVGQPMTPNSASYLPGTPGGQPMTPGNVGMDMMSPIIGGEGEVNWLLPDVLVNVLRA
GDDGPGIVREVLGDGSCRVALGSSGNGDIVTVLPNELEAVRPKKGDRIKILNGNFRGFVG
KLIGIDGSDGIVKLDDTYEVKILDMVILAKLAT
Download sequence
Identical sequences I1GZX5
EG:BRADI1G46230.3 XP_003564120.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]