SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1H0A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1H0A6
Domain Number - Region: 125-192
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000189
Family NRPS condensation domain (amide synthase) 0.048
Further Details:      
 
Domain Number - Region: 211-342
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000289
Family NRPS condensation domain (amide synthase) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1H0A6
Sequence length 442
Comment (tr|I1H0A6|I1H0A6_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK19253.1, ECO:0000313|EnsemblPlants:BRADI1G47190.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g47190v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAKVEVLATELVVPAGETPGGSIWLSNLDLAARRGYTPTVYFYRPKNHGAVDPEEAFFAA
GAVKCSLAKALVAFYPLAGRLGLDDAAGRLQIDCTGEGAVLVTARSDHYALDELMSEFVP
CGEMRDLFVPATPAPNPPCALLLAQVTRLRCGGVVLGLALHHSVVDARSAAHFVETWASI
SRGNHQDAPLVPPCFDHRLLDARPYPARAVLYDHPEYKPEPAPVDVTPVSASTYASAIIT
VSKKQVAALRARCAGASTFRAVVALVWQCACRARALAPGAETRLYSMIDMRPRLAPPLPQ
GYFGNAVVRTSAVVTVDEVVSSPVAYGARRARAATSQGDDYARSLVDYLETVDTMNLPRS
GISRAHLRAISWMGMSLSDADFGWGAPAFMGPALMYYSGFVYVMNAPGKDGAVALALSLE
PDSMPEFKKTFADELARLEVEV
Download sequence
Identical sequences I1H0A6
15368.BRADI1G47190.1 XP_010229918.1.954 EG:BRADI1G47190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]