SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1H0Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1H0Q9
Domain Number 1 Region: 317-607
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-78
Family Protein kinases, catalytic subunit 0.0000664
Further Details:      
 
Domain Number 2 Region: 23-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.57e-66
Family Legume lectins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1H0Q9
Sequence length 651
Comment (tr|I1H0Q9|I1H0Q9_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI1G48432.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100821462 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MLPRSLLLCVFFLLVTSASYPNNGFTYNDFSSSMLRLDGVASITSKALKLTDGAPQKVGR
AFYGRRLDSISSFSTTFVFVITSQYSDLSSHGLAFTLSATTDSLLDALPSQFLGMFNDEN
VGNTTNQLFAVELDTIINSEFRDLDDNHVGIDVNNLVSISSHTAGYYTSNDTFSPLRLAS
GEPMQVWVDYDANSHQVNVSLAPYLERKPERPLLSSIVNLTSVLPRSVYVGFASATGLLR
CIHQIIGWSFNPNGAATPLDYSVLSEVIKDVRREAQSHPDTSRHILLPITIMSVFIVLVM
LVALYIYMKKARKSGEWEIDCGSPSFTYKDLVRATSGFSDRMLLGKGGFGKVYKGMLQTS
SQNVAIKRISPDSKQGMKEFIAEITILGHLRHRNLVQLLGYCRHKNELLIVYDYMPNGSL
DRVLHGQGNQTIDWVHRFNIIKGIASGLLYLHEDWEKVVIHRDIKASNVLLDNKMTGRLG
DFGLARLHNHGTDAHTTHLAGTWGYIAPELARLGRATKATDVFAFGVFMLEVACGRHPIE
VNNYGEPMLLTDWVIDAWESGSVLKTVDPKLEDYVKEEAELVLKLGLLCSHSVHSARPCM
RLVMQYLVKDVLLPDFKASFLSLTIKDEDFDQHILSCNSVATTMTGLSGGR
Download sequence
Identical sequences I1H0Q9
XP_014752095.1.954 EG:BRADI1G48432.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]