SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1H2F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1H2F5
Domain Number 1 Region: 9-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-40
Family WD40-repeat 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1H2F5
Sequence length 301
Comment (tr|I1H2F5|I1H2F5_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK20260.1, ECO:0000313|EnsemblPlants:BRADI1G53420.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g53420v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MLSKKIELDHKDMIHDSAIDYYGKRLATASSDYTVKVVSIGGASAPSKLLATLSGHYGPV
WRVAWAHPKYGAILASCSYDGRVIIWKEGTGGHWSQAHVFADHKSSVNSIAWAPYEVGLC
LACACSDGNIYIMTIRADGGWDTATIERAHPVGATAISWAPATALGLLASSGEVVCKLVS
GGFDSVVKVWEFTNGSWNLDSALPSDMHTDCVRDVAWPPVLGLAKSTIASACQDGKVVIW
TRVKDGDKWQGMVMHDFKTPVWRVSWSLTGNILSVAAGESNITLWKEASGGQWEEVLKVE
P
Download sequence
Identical sequences I1H2F5
EG:BRADI1G53420.2 XP_010228200.1.954 XP_014751766.1.954 XP_014751770.1.954 15368.BRADI1G53420.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]