SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1H4S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1H4S7
Domain Number 1 Region: 607-779
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.58e-22
Family hypothetical RNA methyltransferase 0.051
Further Details:      
 
Domain Number 2 Region: 406-441
Classification Level Classification E-value
Superfamily WW domain 0.0000325
Family WW domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1H4S7
Sequence length 823
Comment (tr|I1H4S7|I1H4S7_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI1G60460.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MLQFAQPSRSADLLPPRASAATHHAAECRAPEPSRPFLLPSPHERIPPFRSPFHNLPQFV
TGKNQGRAATLPCPTGSSARGDAGGGGVFGDKEAGAALQAQRSAPLVIPLSLSESFSGLV
FVSEHFVPYIVIRCRDDSYVTGASETQDWYAAETGCPGSQIAKTRNRAAKQTDEDPSFVE
DMELVSLMGSLGLPVSFSTRKEKKNIAIKGKHQGRQAPCEELNTSTVDDARTCENTEELE
GAQELMGCMEHTNSGISSMTAVGYNEVYHADADKMLGEDMVYVEKSGFVTACSVEKIPRD
EAHNECEPNDNTSNLVESSSPVQENQAAGSVVQLNKVMLGQNSVTNESMMSCTDDCQRGK
SSVREDQISWETPSVSHDNDVDCEVCPCPAEPSPVNNHVEKSASDFNYEHGDWKVLWDQF
YSQYYFFNIMTQVSTWYPPQGLEDFASYCSTYPSQGLDEPSLQYTSTSVQEHNKSSTKCD
KSSGLVCWADNTMDNYISEADRHVVQYEAHMSSCDNGGTTFDQAGVGRHLNHQVHDLYSD
APNLSDVPDEESMCLSAITTIDEAQHDESEQNGSLVTEALEVSQEVTTTKNKKRVRRSQS
YRSCQDLADNISTDIAKYWNQRYSLFSLFDSGIKMDEEGWFSVTPEPIAKHHASRVSAGI
VIDCFTGVGGNTIQFATKCKHVVAVDIDPQKICCAQHNATVYGVNDHIDFVVGDFIHISP
HLKGDTAFMSPPWGGPDYAKVDVYDIKTMLKPCDGYQLFKLATAIASRVVMFLPRNIDLN
QLADMCLSVDPPWSVEVEKNFLNGKLKAITAYFEEQDHADASN
Download sequence
Identical sequences I1H4S7
EG:BRADI1G60460.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]