SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1H742 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1H742
Domain Number 1 Region: 294-577
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.72e-76
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 29-194
Classification Level Classification E-value
Superfamily L domain-like 2.19e-38
Family Polygalacturonase inhibiting protein PGIP 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1H742
Sequence length 592
Comment (tr|I1H742|I1H742_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK22412.1, ECO:0000313|EnsemblPlants:BRADI1G67050.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g67050v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MGSFLRKQPSLLFILIILHFSAREAGSLSSDGEALIAFKKAITNSDGVFLNWREQDADPC
NWKGVRCNNHSKRVIYLILAYHKLVGPIPPEIGRLNQLETLSLQGNSLYGVLPPELGNCT
KLQQLYLQGNYISGYIPSEFGDLVELQALDLSSNSLRGSIPHSLDKLTKLASFNVSMNFL
TGAIPSDGSLVNFNETSFIGNLGLCGRQINSVCKDALPSPSSQQSNPDDIINSKAGRNST
RLIISAVATVGALLLVALMCFWGCFLYKSFGKKDIHGFRVELCGGSSVVMFHGDLPYSTK
DILKKLETMDDENIIGAGGFGTVYKLAMDDGNVFALKRIVKTNEGRDRFFDRELEILGSV
KHRYLVNLRGYCNSPSSKLLIYDYLPGGSLDEVLHEKSEQLDWDARINIILGAAKGLAYL
HHDCSPRIIHRDIKSSNILLDSNFEARVSDFGLAKLLEDEESHITTIVAGTFGYLAPEYM
QSGRATEKTDVYSFGVLVLEILSGKRPTDASFIEKGLNIVGWLNFLAGESREREIADPNC
EGMQAETLDALLSLAKQCVSSLPEERPTMHRVVQMLESDVITPCPSDFYDSE
Download sequence
Identical sequences I1H742
XP_003558273.1.954 XP_010228824.1.954 EG:BRADI1G67050.2 15368.BRADI1G67050.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]