SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1H8Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1H8Q9
Domain Number 1 Region: 58-95
Classification Level Classification E-value
Superfamily WW domain 0.00000806
Family WW domain 0.004
Further Details:      
 
Weak hits

Sequence:  I1H8Q9
Domain Number - Region: 169-197
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.1
Family Di-heme elbow motif 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1H8Q9
Sequence length 230
Comment (tr|I1H8Q9|I1H8Q9_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK23185.1, ECO:0000313|EnsemblPlants:BRADI1G71790.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g71790v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MVSLQSALLPEAKRPPCLSFVDTSVVASTATSKKRKQRDGEGDIEDEEEECGIELNFDAA
PLPLEWQRCLDIKSGQIHYYNTRTHKRTSKDPRRQSAPAAPAPAALEEDEAANYCGPPGL
DLDLNLAFEPRRRTTQPVVAREKKAAIVAKPAAEAKPSAADEAPGMEMVAAVCMRCHMLV
MMSRACPACPNCKFLHPMMTTSGRGGSSSPTPGPEPAPLKLGLQLLCCRD
Download sequence
Identical sequences I1H8Q9
15368.BRADI1G71790.1 EG:BRADI1G71790.1 XP_003561957.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]