SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HAL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HAL3
Domain Number 1 Region: 34-334
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-80
Family Protein kinases, catalytic subunit 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1HAL3
Sequence length 765
Comment (tr|I1HAL3|I1HAL3_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK24030.1, ECO:0000313|EnsemblPlants:BRADI1G77700.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_1g77700v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MVRSGSVRRSSSVAAGMGAAAAAAAAVPEFTVSPDDYRLLEEVGFGANAVVYRAVFLPAN
RTIAVKCLDLDRVNSNLDDVRKEAQIMSLIDHPNVIRAYCSFVVDHNLWVIMPFMAEGSC
LHLMKVAYPDGFEEPVICSILKETLKALDYLHRQGHIHRDVKAGNILIDSPGVVKLGDFG
VSACLFDRGDRQRSRNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFS
KYPPMKVLLMTLQNAPPGLDYDRDRKFSKSFKEMVAMCLVKDQTKRPTAEKLLKHSFFKN
TKAPELTVKSIITDLPPLWDRVKALQLKDAAHLASSEQEALSMSEYQRGVSAWHFDIEDL
KTQALLIHDDGPLELKEDESVRVTEVHKDTSSGSHVGKSTLLTGNNCSERTCATAVNPGV
NGPEPSEELAFNLGNADSERKADGYRNQGSENDSLSSTSKHDSEGENRGSEVRQKQRTYS
GPIMYSGLRNSSVAEKGSIIDRDAGGQVSNKQKNDARRTNDLSGPLSLSTRASANSLSAP
RRTDDLSGPLSLSTRASANSMSAPIRSSGGYVGSLGDKPKRNMVEIKGRFSVTSENVDLA
KVQEIPVGKISHKPQEGSALRKSASVGAWPVNAKQMSNSQHRKALCDNSASASVLIPHLQ
NLVQQTTFQQDLITNLLCSLQQNENVDAAQSRVQTVEGDTVVETGSAEGERPLLAKIFEL
QSRMISLTDELIASKLKHVQLQEELNALYCQEEIIDTREEDNEEA
Download sequence
Identical sequences I1HAL3
XP_003558987.1.954 15368.BRADI1G77700.1 EG:BRADI1G77700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]