SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HDY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HDY5
Domain Number 1 Region: 82-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000968
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  I1HDY5
Domain Number - Region: 139-182
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0746
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1HDY5
Sequence length 458
Comment (tr|I1HDY5|I1HDY5_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK03620.1, ECO:0000313|EnsemblPlants:BRADI2G08920.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_2g08920v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAREPSPEIDDELFNEVYGKAYSGPVATATNSVTPKVNDEKKPLAHDKSDEEDDPRDPNA
VPTDFTSREARVWEAKAKATERNWKKRKEEEMICKICGESGHFTQGCPSTLGANRRNADF
FERVPARDKQVRDLFTERTISQIEKNVGCKIRMDEKFLFVSGKDRLVLAKGVDAVHKLIQ
ESKGKHSSSSPKRDRSRSPVRNSADFRLRHPDSRWSHSPRNASHSQSRGPHNERPLVGRL
RDDMPKYPKGSPQAYANNGAKDRPVRSKSPCEPSYLDDHLRSHGGNNQYATAHMPNNCST
ERYGTDSRLDLKFELPSYPQTLEELEIEFKREAMELARARDQEEDEENCKHRETLREIRE
NHMKRVSATRSMQARKWSEFLEQSFRRQQQAQQTSYTQTGYPDFDQRTAHFPTTAPAIDS
KNAYPYPTDNYSAAPRRHAYDEFQHERHGDLGRTYGRY
Download sequence
Identical sequences I1HDY5
15368.BRADI2G08920.1 XP_010230702.1.954 EG:BRADI2G08920.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]