SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HH24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HH24
Domain Number 1 Region: 23-317
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.87e-53
Family WD40-repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1HH24
Sequence length 1012
Comment (tr|I1HH24|I1HH24_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK05140.1, ECO:0000313|EnsemblPlants:BRADI2G18270.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_2g18270v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MKGRALKLREAHKAGSPPVFCTAVWGPGGQHVVTACASDVAVLIHDAAAVAAGGGRGSDP
AAVVTTIRLHKDGVTALAVAPGSGGSLASGSIDHSVKFYSFPGGEFQGNVARFTLPIRSL
AFNRKGTLLAAAGDDDGIKLIATIDNTISKVLKGHKGSVTGLAFDPKNDYLASVDSFGTV
IYWDLCLGNVSRTLKRVAPTFGSDHSVKNGLCWSPDGQTLAVPGLRNNVVMYDRDTGEEV
FTLKGEHEQPVCSLCWSPNGRYLATASLDRQVLIWDVKSRQDIERQKFDERICSLAWKPE
ENALVLIDVTGKFAIWESVVPSTLKSPTEGAPDLNITRVPFFDDDDEEEKASTSAGFDDD
VDESLGELGPSSHKRLRRKSAFGDHSNGDNEDEDLIHHMESYKRTKHKHKDTKEDVGKAI
DDTATSGRFVTARMQVSFQPGATPSQPGKRNFLAYNMLGSITTIENEGHSHVEVDFHDTG
RGPRVPSMTDYFGFTMAALNESGSVFANPCKGDKNMSTLMYRPFSSWAGNSEWSMRFEGE
EVKSVALGAGWVAAVTSLNFLRIFTEGGLQMHILSVSGPVLTAVGHGDQLAIVFHSSDCL
PSGDQVLDVKVFNISEGAQAMSSRLVLTPSSQLSWFGFSENGQLSSYDSKGILRVFSSQF
GGSWLPVFSSMKARKSEDESHWVVGLDANNIFCVLCKSPDCYPQVMPKPVLSILEFSFPL
ASSDLGANNLENEFMMKRLHLSQIQKKIEEMAALGLDVTAFEDEAFNTEAALDRCILRLI
SSCCNGDKLTRATELAKLLTLGKSMKGALTLVTRLKLPILQEKFSSILEERMLNDTRTPG
AIGVCSSATTAKYSPSLTTHAIQPAKTVQNGNNMEASAAPALNPFSPQRSSAPGSKKAEV
EQLKEPKVTEKASPSVTPLAKMPKKNEKAQGIAKTNRDVTAVVEQLPKGVIDQVGVKNKS
NEDSNRVEPQRPVNPFAKPSSNKDKSSSLLDSIKKMKVENEKVDKSNSKVKV
Download sequence
Identical sequences I1HH24
15368.BRADI2G18270.1 EG:BRADI2G18270.1 XP_003567995.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]