SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HIE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HIE2
Domain Number 1 Region: 225-569
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-31
Family Protein kinases, catalytic subunit 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1HIE2
Sequence length 586
Comment (tr|I1HIE2|I1HIE2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK05739.1, ECO:0000313|EnsemblPlants:BRADI2G22210.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_2g22210v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MASSLLPPPTFANKHRSLLATAKHPAPRLTRCGAGGGAVPDELLGALHLGRQSDTVVATV
GVSEDTSADGWIDLLDEIKGALQADAPDPAATASDAPVVPDVLLSSPPASVDAANAAAGM
AVAVPDEALTSAADTSRFIPEELLGALHMDASSPPVRAATGALARLDALAASLTEPERWA
AAGLLAVVWLYLTARPGVLSGAVDAYLLAPLQLALDSALGRRSLKMSDFVVGERIGEGSF
GVVYSGAVVPKGGAAVEERRGKAKTKLQLDDRYKEKVILKKIKVGTAGAKECGDYEEWFN
YRVARAAPESCADFMGSFVADKTKSEFVKGGKWLVWKFEGDRTLGNYVTDKSFPSNLEPL
MFGRALRGADSLTRGALVVKQVMRQLITSLRRIHDTGIVHRDIKPSNLVVTRRGQVKLID
FGAATDLRIGKNYTPDRTLLDPDYCPPELYVLPEETPQPPAEPIAAILSPILWQLNSPDL
FDMYSAGVVLMQMAIPTLRSPSGLKNFNSELKAAGYDLNRWREITRRRPDLQILDLDSGR
GWDLATKLIAQRGQGRLSAAAALRHPYFLLGGDRAAAVLSKLQLSK
Download sequence
Identical sequences I1HIE2
XP_010231260.1.954 15368.BRADI2G22210.1 EG:BRADI2G22210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]