SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HMV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HMV9
Domain Number 1 Region: 399-495
Classification Level Classification E-value
Superfamily L domain-like 6.33e-20
Family Polygalacturonase inhibiting protein PGIP 0.0083
Further Details:      
 
Domain Number 2 Region: 569-623
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000256
Family Protein kinases, catalytic subunit 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1HMV9
Sequence length 671
Comment (tr|I1HMV9|I1HMV9_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI2G38930.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAPPSWPPCLLLLLLCLAGGGILQPGAQPDSKGFISIDCGYPGETSYVDDTNGLSYSPDA
GFTDAGTNRNISGEYVRPLLSRRAHNLRSFPDGRRNCYTLRSLVSGLKYLIRANFVYGNY
DGLNRPPASFDLHIGVNFWTTVNLSSWSDPVGSLAWVEAVVVVPDEFVQVCLVNTGGGTP
FISGLDLRALKRKLYPQATVEQGLVAIGRFNAAPTNKSYIARYPDDPHDRIWYPWYDATI
WAELSTTHTVTNADYGLFEAPPVVMQTAITPRNGSRSIVFYWDAEPTPNDPSPGYIIVMH
FAELQLDAVRNFYVNLNGKPWYSDAYTPDYLRSNAVYDIVPNRQRHYNLTIDAATNSTLP
PILNAVELFSVIPTTIVGTDSQDASAAMEIKAKYQVHKNWMGDPCLPKTMAWDRLTCSHA
IASRPRITSLNMSSSGLTGNISTSFADLKALQYLDLSNNNLTGSIPDALSELPSLTVIDF
SGNQLHGSIPPGLLKRIQDGTLDLRHGNNSELCTGSNSCQLSAKRKNKVAIYVAVPILVI
LVIVSAAILVFFLLRRRNQQQGSMNNMTTVKPQNEEAQILTRIHHKNLVSMIGYCKDGKY
MALVYEYMAEGTLREHIADVSSNKETTATEHVYLGNKDSGSHLNLPKGWSTYTRGATRLS
STEMSRPPTSC
Download sequence
Identical sequences I1HMV9
15368.BRADI2G38930.1 EG:BRADI2G38930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]