SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HR89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HR89
Domain Number 1 Region: 22-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.1e-30
Family Heat-shock transcription factor 0.00097
Further Details:      
 
Weak hits

Sequence:  I1HR89
Domain Number - Region: 114-176
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1HR89
Sequence length 247
Comment (tr|I1HR89|I1HR89_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK09598.1, ECO:0000313|EnsemblPlants:BRADI2G48990.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_2g48990v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MGSECKGHHQVQDDEAGGPGAIAPFVAKTFHMVSDPATDGVVRWGGASNTFLVLDPAAFS
DLLLPSYFKHRNFASFVRQLNTYGFRKVDPDSWEFAHESFLRGQAKLLPLIVRKKKKAGA
RGELCEEEEEVRGTIRAVQRLRDERKGMEEELQAMDRRLRAAENRPGQMMAFLGKLADDP
GVVLRAMVAKKEELSAAAGGGKDSSSPQKRRRIIGAEAGRGGAVSAADAAESRAVPFPFS
ALGQVFY
Download sequence
Identical sequences I1HR89
XP_003569736.1.954 EG:BRADI2G48990.1 15368.BRADI2G48990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]