SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HRS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HRS6
Domain Number 1 Region: 10-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-92
Family Protein kinases, catalytic subunit 0.00000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1HRS6
Sequence length 481
Comment (tr|I1HRS6|I1HRS6_BRADI) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00351747} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_2g50430v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MEKNQDSQVIMGRYRLGRLLGCGSFAKVYKAHNVSTGEAMAIKVFDKEAVRRSGTMEQVK
REVAVMRRVRHPNVVRLHEVMATRSRIYFVMEYAGGGELFARLARSTRFPEPVARRCFQQ
LVTAVEFCHSRGVYHRDLKPENLLLDARGNLKVSDFGLSALAADTSRLRGGGLLHTTCGT
PAYVAPEVLRKRGYDGAKADIWSCGVILFVLMAGKLPFNDANLPVLYRKITQSDYKCPEW
FSVDARKLLARLLDPNPRTRITIAKLKARSWFREGAPCPLLNEKPLATSEEASVLLGKEG
ARAGHHDEDDDEESTRKRKRSKVTTASSPTIRVRPSSMNAFDIISRSNALDLSKMFDEAE
RRSEARFSTKETTTAIVSKLGKIAEAGRFSFKLKDKARVELEGSQDGRNGALPLALEVEI
FEVAPSVHVVEMRKTGGDSLEFRDFYKHELKPSLGDIVWAWQGADSPPPSLVPRPNTESR
S
Download sequence
Identical sequences I1HRS6
XP_010232357.1.954 15368.BRADI2G50430.1 EG:BRADI2G50430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]