SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HW54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HW54
Domain Number 1 Region: 211-287
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000000111
Family Biotinyl/lipoyl-carrier proteins and domains 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1HW54
Sequence length 301
Comment (tr|I1HW54|I1HW54_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ92814.1, ECO:0000313|EnsemblPlants:BRADI3G00880.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g00880v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MGSRQLCDQYATHLAAAAHAGGRHGALLPHARRVFDATPERNLVTGNSLLSALARARGHV
RDMERLFASLPRRDAVSYNALLAGLARAGAHARAAGAYRALLRDEDGVRPSRITMLGLVM
DASALGDRALGRQAHGQILRLGFAAYAFTGSPLVGMYAKAGLVGDARRVFDEMEGNNVVL
RKESRALDFLSTINLGKIIRPSRYYHQGLSQVVQGNIAKWVKKEGDKVSPGEVLCKVETQ
LLSLIFEFFPLDKATVEMECMEEGYLAKIVQGDGAKEIKVGERVASRSLKTTNLQHLQMR
L
Download sequence
Identical sequences I1HW54
EG:BRADI3G00880.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]