SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1HZ17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1HZ17
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily RING/U-box 0.000000598
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  I1HZ17
Domain Number - Region: 106-181
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000178
Family Myosin rod fragments 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1HZ17
Sequence length 295
Comment (tr|I1HZ17|I1HZ17_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ94149.1, ECO:0000313|EnsemblPlants:BRADI3G08880.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g08880v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MKCNACWREMEGQAISTTCGHLLCPEDAKKILSADGACPICDQVLSKSHMKPIDINPSDE
WTNMSMVGISPQILMKSAYRSVMFYIGQKELEMQYKMNRVLGQCRQKCEHIQAKFTEKLE
EVHTAYQKMGKRCQLMEQEIENLTRDKQELQEKFAEKSRQKRKLDEMYDQLRNEYESVKR
SAIQPANNYFSRAQPDLFSGMPNILDSGNPLRQGRREEGWAPQPRQRRENSGPFELSAGS
PGHTAAPPMDMRPRQPARSTFGANMNNSSAALRNMIISPMKRPQLSRNRPQLFTL
Download sequence
Identical sequences I1HZ17
XP_010234083.1.954 15368.BRADI3G08880.1 EG:BRADI3G08880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]