SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1I079 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I079
Domain Number 1 Region: 240-328
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000137
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1I079
Sequence length 349
Comment (tr|I1I079|I1I079_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ94744.1, ECO:0000313|EnsemblPlants:BRADI3G12910.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g12910v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MGGGDGRHGDGGGGSHPHQFQYQALLAAVHTQNPNHNTLPFPLPPLNGNGPDAPANNAAR
HPPAPRGFADWSASNSAFTSLAAQSTPAASTAASANNAYHYGVTPCYAFWTHYMLNKSGY
SYYPPQHQEHLHPFCPDSQQAKNTGSALSFGVDSFTSTPVAPNISLAPNSSAHMPPMEGR
LSTREPETSEDVPRVVRRKAGMETRNGGEDNCETVDTLPELNQGHESCATKLNSGEYEVI
LRKELTKSDVANVGRIVLPKKDAEAGLPQLCQRDPMILKMDDMVLPVTWKFKYRFWPNNK
SRMYILDSTAEFVKTHGLQAGDALVIYKNPVPGKFIIRGEKAIQHPTNP
Download sequence
Identical sequences I1I079
XP_003573243.1.954 EG:BRADI3G12910.1 15368.BRADI3G12910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]