SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1I099 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I099
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.26e-33
Family Canonical RBD 0.00067
Further Details:      
 
Domain Number 2 Region: 108-144
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000297
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1I099
Sequence length 226
Comment (tr|I1I099|I1I099_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ94765.1, ECO:0000313|EnsemblPlants:BRADI3G13040.3} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g13040v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MSDADEYRCFVGSLSWSTTDVDLKDAFGKFGRVTETKVVLDKYSGRSRGFGFVTFDDKKA
MEEAVEAMNGIDLDGRNITVERAQPQGSGRDRDGDYRGGGGDYGRDRGRDFGGGRGGGGR
GGGGDCYKCGKPGHFARECPSGDGGDRYGSRDDRYGGRDDRYGGRDSGRDDRYGGSNGSS
RYGPDRGGDRYSGSRDGGSRSGGGGGGDRYSRDRSGPYERRSRDGY
Download sequence
Identical sequences I1I099
15368.BRADI3G13040.4 EG:BRADI3G13040.1 EG:BRADI3G13040.3 XP_010234241.1.954 XP_010234242.1.954 XP_014756466.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]