SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1I239 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I239
Domain Number 1 Region: 24-163
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.22e-54
Family C-terminal domain of ribosomal protein L2 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1I239
Sequence length 165
Comment (tr|I1I239|I1I239_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI3G18424.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MLWKKLVQFGKGFFERKEESTSTDMPLGTAMHNIEITRGRGGQLARAAGAVAKLIAKEGK
SATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPIVRGVVMNPVDH
PHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
Download sequence
Identical sequences I1I239
EG:BRADI1G05800.1 EG:BRADI3G18424.1 15368.BRADI1G05800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]