SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1I247 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I247
Domain Number 1 Region: 28-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-51
Family WD40-repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1I247
Sequence length 345
Comment (tr|I1I247|I1I247_BRADI) Uncharacterized protein {ECO:0000313|EMBL:PNT66915.1, ECO:0000313|EnsemblPlants:BRADI3G18490.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g18490v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MNTPKLQFLGNIAHKKVYKSRIADMAMVQIVQEINHDGPVYRARYMPQNSFIIATKTDSG
EVYVFDYRKHPAKPPLNGACNPDLRLKGHNSEGYGLSWSIFKEGHLLSGSDDVKICLWDI
KANGKNKTLDAYQTFKFYHHGNVEDVAWHLRHGYLFGSVGEDRNLLIWDLRSSASSKPVQ
SVEEHQSEVNCLAFNPLNEWVVATGSTDKTVKLFDLRKIDTSLHTLNFHKEGIVQLGWCP
KNEAVLASSCLGKKLMVWDLSRIGREQSPEDAEEGPPELLFIHGGHKRNISDFSWNQCED
WMLASVDEENILHVWQIAQHVYDDDHEDDFPGDNRPAFQKLFETL
Download sequence
Identical sequences I1I247
EG:BRADI3G18490.1 15368.BRADI3G18490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]