SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1I333 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I333
Domain Number 1 Region: 115-323
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.000000155
Family ATP-binding domain of peptide synthetases 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1I333
Sequence length 349
Comment (tr|I1I333|I1I333_BRADI) Inositol-tetrakisphosphate 1-kinase {ECO:0000256|PIRNR:PIRNR038186} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g21470v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MRVHEGASDEEVEEPVASAMLAPVALSPPPAASSGSQRLVVGYALTKKKVKSFLQPKLLA
LARKKGINFVSIDETCPLSEQGPFDIILHKRTNKEWQQVLEDYREEHPEVTILDPPSAIQ
HLHNRQSMLQEVTDLNLSNSYGEVCAPRQLVIMKDPSSIPAAVAKAGLTLPLVAKPLVVD
GTSKSHELSLAYVDTSLSMLDPPLVLQEFVNHGGILFKVYIVGETIRVVRRFSLPDVNAY
DMENNDGIFRFPRVSCATNNAEDADIDPCIAELPPRPLLEKLGKELRRRLGLRLFNLDMI
REHGSKDRYYVIDINYFPGYGKMPGYEHVFTDFLLSLVQSKYKRRLSGS
Download sequence
Identical sequences I1I333
XP_003573753.1.954 EG:BRADI3G21470.1 15368.BRADI3G21470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]