SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1I797 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I797
Domain Number 1 Region: 227-448
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.22e-62
Family CAT-like 0.00017
Further Details:      
 
Domain Number 2 Region: 42-127
Classification Level Classification E-value
Superfamily Single hybrid motif 1.96e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1I797
Sequence length 449
Comment (tr|I1I797|I1I797_BRADI) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex {ECO:0000256|RuleBase:RU003423} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAATPAPLSLSASALSARLRLAAPASRAASARRRGPMVVRAKIREIFMPALSSTMTEGKI
VSWSAAEGDRVTKGDAVVVVESDKADMDVETFYDGIVAAVLVPAGESAPVGAPIALLAES
EEDVALAVAQAQALSSGQAQQAPPPSDADAPPPPSPPPAAAAPAPVAAGRRVLPRRRLRS
WPSSTGGPCQAGIQPKPKVAPPTAAAPVAAPSVRAVPQASVLPPVPGATVVPFTAMQAAV
SKNMVESLSVPAFRVGYPILTDKLDELYEKVKPKGVTMTVLLAKAAAMALAQYPVVNASC
RDGASFTYNSSINIAVAVAIDGGLITPVLEQADKLDIYLLSQKWKELVKKARAKQLQPNE
YNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVTADKDGFFSVKNKMLVNVTA
DHRIVYGADLAAFLQTFAKIIEDPESLTL
Download sequence
Identical sequences I1I797
15368.BRADI3G36520.1 EG:BRADI3G36520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]