SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1I9F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1I9F1
Domain Number 1 Region: 495-649
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.38e-69
Family Cyclophilin (peptidylprolyl isomerase) 0.000000536
Further Details:      
 
Domain Number 2 Region: 89-320
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.66e-30
Family WD40-repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1I9F1
Sequence length 652
Comment (tr|I1I9F1|I1I9F1_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ99346.1, ECO:0000313|EnsemblPlants:BRADI3G42750.2} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g42750v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MATTSDPTADPALPTETAEGDAVQEQEHGNGAAAAPAVVLQQQGQGEEEEELIGPGPAPA
RQRQKRPLQFEQAFLDALPSAAMYEKSYMHRDVVTHVAVSPADFFITGSADGHLKFWKKK
PSGIEFAKHFRSHLSPIEGLAVSVDGLLCCTISNDRSVKIYDVVNYDMMFMMRLPFVPGA
IEWVYRQGDVKPKLAVSDRNTSFIHVYDTHSGSVDPVISKEIHSGPVKVMKYNHAQDVVV
SADAKGLLEYWSPSTLKFPEDVVNFRLKTDTNLFELAKCKTSVSAIEVSNDGTQFAVTSP
DRRIRVFWFKTGKLRRVYDESLEVAQDLQKSDVPLYHLDAIDFGRRMAVEKEIEKTENVP
QPNAVFDESSNFLIYATLLGIKVVNLHTNKVSRILGKVENNERFLRIALYQGDKGNKKVR
KIPSIAANVNDSKEPLSDPTLLCCAFKKHRIYTFSRREPEEPEDATKGRDVFNEKPPPEE
LLSVSELGKTATTSLPDNLVFHTSMGDIHLKLYPEECPKTVENFTTHCRNGYYDNLIFHR
VIKGFMVQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFIT
TVATPWLDNKHTVFGRVVKGMDVVQQIEKVKTDKNDKPYQDVKILNVTVPKT
Download sequence
Identical sequences I1I9F1
15368.BRADI3G42750.2 XP_003574923.1.954 XP_010235404.1.954 EG:BRADI3G42750.1 EG:BRADI3G42750.2 EG:BRADI3G42750.3 EG:BRADI3G42750.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]