SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IB33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IB33
Domain Number 1 Region: 73-163
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.47e-25
Family Ribosomal protein L14e 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1IB33
Sequence length 219
Comment (tr|I1IB33|I1IB33_BRADI) 60S ribosomal protein L6 {ECO:0000256|RuleBase:RU000662} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g47410v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAPTSKMALGIKRASRSHSYHRRGLWAIKAKHGGAFPKAEKPAAVAEPKFYPADDVKPRN
PSTRKPNPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRV
NQTYVIATSTKVDISGVKVEKFDDKYFARDKKARAKKTEGELFETEKETTKNLPDFKKDD
QKTIDAELIKAIEAVPDLKNYLGARFSLRDGDKPHEMTF
Download sequence
Identical sequences I1IB33
EG:BRADI3G47410.1 XP_003575257.1.954 15368.BRADI3G47410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]