SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IDC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IDC3
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.17e-19
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 89-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000912
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1IDC3
Sequence length 194
Comment (tr|I1IDC3|I1IDC3_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK01079.1, ECO:0000313|EnsemblPlants:BRADI3G53760.3} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g53760v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MARLYVGNLDARVTAGELEDEFRVFGALRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG
KNGWRVELSRNSSGRGGGRDGGGGGRDRHGGSESKCYECGESGHFARECRLRIGAGGLGS
GRRRSRSRSRSPRNRRSPSYGRRSYSPRDRSPRRRSVSPARGRSYSKSPTYNRGRDDSPD
AKGNDGTRYRRSRS
Download sequence
Identical sequences I1IDC3
15368.BRADI3G53760.3 XP_010235900.1.954 EG:BRADI3G53760.1 EG:BRADI3G53760.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]