SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IDH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IDH0
Domain Number 1 Region: 26-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-36
Family Protein kinases, catalytic subunit 0.0034
Further Details:      
 
Domain Number 2 Region: 492-615,655-840
Classification Level Classification E-value
Superfamily ARM repeat 2.4e-32
Family HEAT repeat 0.019
Further Details:      
 
Domain Number 3 Region: 1031-1287,1329-1366,1418-1450
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.31e-30
Family WD40-repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1IDH0
Sequence length 1450
Comment (tr|I1IDH0|I1IDH0_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQK01155.1, ECO:0000313|EnsemblPlants:BRADI3G54140.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_3g54140v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MGNKIARTTQASATEYYLHDLPSTYNLVLLDVVSRGRFLKSVLCKHDEGLLLVKVYFKRA
GEPLDLKEHERRLERIRNAFQGLEGSHVWPFQVWFQTDKAAYLLRQYFYSNLHDRLSTRP
FLSQIEKKWLAFQLIHAVEQSHSKGVCHGDIKCENVLVTSWNWLYLADFASFKPTYIPDN
DPSDFSFFFDTGGRRRCYLAPERFHEHGGESQVSADAPLQPSMDIFSVGCVLAELFLEGQ
PLFELSQLLAYRRGQYDPLHTLEKIQDADIQDMVLHMIQLDPKERLSCKSYLQKYETVVF
PTYFSRFLHKFFSDIVPLDSDARVEKTQENFERIHDMMISGSTSEHIQVSEKKGIGGQVI
NSPRESSKGTSSVKKNIPRDHRQIVGDLNSLLKEVEQRNNHADSKAMKYTDSYAASNVSR
ANGIEPSPQVNETRIQTARVLAGQNNDVSHVHKISKSNLPALVSTYDVQSDTYSFDIFQQ
IHTKVSCEGMVLLASLLCSCIRSVKKPELRRASLILLKISSTYIDDDSRLQLVIPYVIAM
LSDPAAIVRCAALETLSDVLCLVQDFPISDAMIFPEYILPMLSLLPDDTEESVRVCYASN
IYKLALTAYRFLLHSRSIADTGPLDKSMVAAVSQSAESPAKKQQDKIHRQLARLRRCIYD
IVQELVMGPKQTPNVRRALLQDIGYLCYFFGHRQSNDFLLPILPAFLNDHDEQLRAVYFG
QIVVVCYFIGPRSVEEYLLPYLEQALSDDMEAVVVNVLDCLTMMCGSGYLRKRIIVGLFG
KALPLLCHPIQWVKRSAVRLIAACSESLGPVDTYVYLSPHLRQFLHREPPSISEAALLAC
LKPPVSKSVLYQALEVAKDTGDVVLKGGGKKEQTVHGGRYPATAQSGSLAALEDAARLRS
SNLSSNVSLDIKDSISSDKSLYYGYAQHASAGNSSFYDGLSKGIPSYSVCTDKRGLGEIF
MPWESNRHPGLSTSVQGLQTRENHFSSKHISESMKSSSSVPGDSVSNPETAGTPSFIRSA
VVLETGWKPRGVLVAHLQEHRMSVNDIAVSDDNAFFVTASDDSSIKIWDTRKLEKDIAFR
SRLTYSLGSSRALCTTMLYGSSQVIVGDSDGTLHLFSVDCARGVGSITDRYSGLVNVNRK
DLKEGAILSVINCSSDSFSPTILFSTEHCDIHKWDTRTNSESWSFKSSPEEGYISALVVG
QCGNWFISGSSRGVLTLWDHRFLLPVNSWNYSTVSPIERLCLLIPPQNSISSAGRPLVFV
AAGCNEVSLWNAENGSCHQMFRTASTENEAGMPKTPLRPINKTVTKDVRRAGSYKYRIEE
LADPHPRLPGIRCLLPLPGGDLLTGGTDLKIRYWDQARPEQSFCVAGPSAKGVGNDECYD
IKSSFGVQVVQETCKPPTSASRLTHKTQLAMAAADSAGCHRDAILALASVNLSNQRLISA
SRDGAVKVWK
Download sequence
Identical sequences I1IDH0
XP_003570301.1.954 15368.BRADI3G54140.1 EG:BRADI3G54140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]