SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IGR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IGR2
Domain Number 1 Region: 49-117
Classification Level Classification E-value
Superfamily F-box domain 0.000000746
Family F-box domain 0.018
Further Details:      
 
Weak hits

Sequence:  I1IGR2
Domain Number - Region: 157-191,238-380,415-476
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00876
Family Galactose oxidase, central domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1IGR2
Sequence length 598
Comment (tr|I1IGR2|I1IGR2_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI4G02547.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MRSLFPSPVQPFLPFFSSERIKMDGPSMLQTYYDQGSMAGGGGHVDQTARLSGDEFAEIL
RRVPPRWLAASRCVSKSWRAAIDGHGLLRADLLPLSVAGLFFHLNQHIYPEFLSCPSSSV
SGRLDFLRHANPKFRGGRRIPDYRVLDQCNGLLLLPQWVVNPATGRWITLPPSPAKEEDP
RNRVWCYQRFLDYDPTVSPHLEVLMVPSLVNNDYYEEEEEENPLVAMGMAGLEWPPSPCK
MHVFSSRSGRWEERSFVREGDAAGTLGELRLGLSCCAAAHLRGTLYIHCLADSIMRISLA
DNTYRMIKTPVYAAGLKPYRLRIDMGRSENGVYFASLHNGCLRVWILKELCGGEVEWILK
HENDLKPIPSFSSTAGALAAAPVSGRLDLLCRANPKFFGDPDKFGHWWDDEAIDHYDYKI
HHHCNGLLLLEQWVVNPATGWWTALPPTPSPAMEDTKNDVWYYDRFLVYDPTCRRTSRSP
EPRPGRRAPPHWRGSPATATSSTAPPHKRKDLAASPPLLCSLSSAERPLSVVRLRRAAQP
PPSSAAALCSTAGDSVSIAPSTGPLLHSAGLQVSLPKPPLDSSSHLSTNTSIDFQFQL
Download sequence
Identical sequences I1IGR2
EG:BRADI4G02547.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]